Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDSNMEVLIKTEDAIDAYNGAANLARSLGVSRAAISQWGEYVPEVSARGLVILQPSIPHIIKKPSAT 3JXB Chain:C ((21-56)) ---------------------AALGKMVGVSNVAISQWERSETEPNGENLLALSKAL----------

General information: TITO was launched using: RESULT: Template: 3JXB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 100 -14647 -146.47 -406.85 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain C : 0.69 3D Compatibility (PKB) : -146.47 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.594

(partial model without unconserved sides chains): PDB file : Tito_3JXB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3JXB-query.scw PDB file : Tito_Scwrl_3JXB.pdb: