Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------MALTEKKKAFALAKRNGKDNKEAAILAGCPEKTASAAGARLAKDP--DVIAYLERLE------EATPEQAVKHEVKPLTTFTSI------QTANKLDDPLEFLKSVYTDQV--EDMALRVRAAQAALPYVHGKVAEKGKKETKEDAAKAATKTGKFGTLNNQLPS
5BOP Chain:B ((2-192))AFLIVKGPSEKRNHEKAERFFELLVREGVEAIIIARGVSEREIEQAAKLAREKGFEALAFLAEYERRDRQFDDIIEYFERYGFKAVIVATGLDEKELKQAAQKIEEK-GFKALAFSGRIDQENHNINDIFELLQRQGLRAIIAATGLSERELSWAQRAAQQYGLDIIF-----


General information:
TITO was launched using:
RESULT:

Template: 5BOP.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 686 65447 95.40 457.67
target 2D structure prediction score : 0.51
Monomeric hydrophicity matching model chain B : 0.68

3D Compatibility (PKB) : 95.40
2D Compatibility (Sec. Struct. Predict.) : 0.51
1D Compatibility (Hydrophobicity) : 0.68
QMean score : 0.161

(partial model without unconserved sides chains):
PDB file : Tito_5BOP.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5BOP-query.scw
PDB file : Tito_Scwrl_5BOP.pdb: