Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMPRKGPVAKRDVLPDPIYNSKLVTRLINRVMVDGKRGIAANIIYNAFDLIKESTGNDPLEVFEQAMKNVQPVLEVKARRVGGSNYQVPVEVRPERRVTLGLRWVVNYARLRGEHTMEERLAKEIMDAANNTGASVKKREDTHKMADANRAFAHYRW
1HNX Chain:G ((2-156))-ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW


General information:
TITO was launched using:
RESULT:

Template: 1HNX.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output




QMean score : ?

(partial model without unconserved sides chains):
PDB file : Tito_1HNX.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1HNX-query.scw
PDB file : Tito_Scwrl_1HNX.pdb: