Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-MVHRLEEPEERKEYLI-SPKLRLKSVSQKIWVIDSGEYQTMLLPEEY------------------------
2W8X Chain:A ((1-72))FNCNKREGPCSQRSLCECDPNLQLGRHSDQLWHYNLRTNRCERGGYRDNCNSHSSSGACVMACERIHHHHHH


General information:
TITO was launched using:
RESULT:

Template: 2W8X.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 121 8788 72.62 191.03
target 2D structure prediction score : 0.61
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : 72.62
2D Compatibility (Sec. Struct. Predict.) : 0.61
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.209

(partial model without unconserved sides chains):
PDB file : Tito_2W8X.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2W8X-query.scw
PDB file : Tito_Scwrl_2W8X.pdb: