Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------------------------------------------------------------------------------------------------------------------------------------------------MFRRYPYSDSSNSEEKRRKNMKYFQLVLTLITAMVIEVLEQKLA-----------------------------------------------------------------------------------------
3CMN Chain:A ((43-395))LIDWEQARQAALRLSQWEQAPVDNRAFRREQYARMVALSEPLIADYLGVRLPEPVSRIFVFDRREWLEANIVSFSQLFRPIEEMYEKSSKLLGVQIGGLLGYLAQRVLGQYDLSLLSAGGSLYFVEPNIARVQQQLGLSDEDFRLWITLHEMTHAFEFEAYPWVRTYFRELLEQNFALT-----PEQRAVFDRIQALMSLIEGYGNHVMNAVGRRLLPSFNQIEQQIAQRQRQRTMLDQMVFRLTGLDLKLAQYQQGEAFVNAVVAARGIQFASRVWERPENLPSMDEIRNPGQWIVRMDREG


General information:
TITO was launched using:
RESULT:

Template: 3CMN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 16 1124 70.22 28.81
target 2D structure prediction score : 0.95
Monomeric hydrophicity matching model chain A : 0.53

3D Compatibility (PKB) : 70.22
2D Compatibility (Sec. Struct. Predict.) : 0.95
1D Compatibility (Hydrophobicity) : 0.53
QMean score : 0.220

(partial model without unconserved sides chains):
PDB file : Tito_3CMN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3CMN-query.scw
PDB file : Tito_Scwrl_3CMN.pdb: