Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFRRYPYRDSSNSEEKRRKNMKYFQLVLTLITAMVIEVLEQKLA 2M8V Chain:A ((1-33)) -------------ADRGWIKLKDCPNVISSICAGTIITACKNCA

General information: TITO was launched using: RESULT: Template: 2M8V.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 49 -7953 -162.31 -256.55 target 2D structure prediction score : 0.06 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -162.31 2D Compatibility (Sec. Struct. Predict.) : 0.06 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.022

(partial model without unconserved sides chains): PDB file : Tito_2M8V.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2M8V-query.scw PDB file : Tito_Scwrl_2M8V.pdb: