Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MISIIWFLFFFIFFSYLKVIKIDSFLVYHTSAMKNLTQNLLKKDNSSILKIELKKENNKSMKISKKAFLLVVLILLSTLYSVNFMRNAQEIYTTGDLSFHLSRIKGLSSIFE--GPINYTTFNNYGDGLNYFYPFLTIIPAVVFYGISN-----NLILSYVLYIWLLNICTILISFWERQ 3WAJ Chain:A ((43-188)) -------------------------------------------------------------------------------------------LGGNDPWYYYRLIENTIHNFPHRIWFDPFTYYPYGSYT--HFGPFLVYLGSIAGIIFSATSGESLRAVLAFIPAIGGVLAILPVYLL--

General information: TITO was launched using: RESULT: Template: 3WAJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 223 -51288 -229.99 -657.53 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : -229.99 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.179

(partial model without unconserved sides chains): PDB file : Tito_3WAJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3WAJ-query.scw PDB file : Tito_Scwrl_3WAJ.pdb: