Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------MIFFISEYINQTPFYSKNTEKINGGQVSTD-FSIIVYFSGAFTDDKNFIM---------NLKNDTTKIKK- 5T5I Chain:G ((2-81)) AIGLKAYPELCHGCGNCVIACPVNALRSPEVAGGKGPTDDVEIIMIVEDGVVNIKNPDLCGKCGTCVESCPVDAIRLEEL

General information: TITO was launched using: RESULT: Template: 5T5I.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 207 23684 114.41 394.73 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain G : 0.68 3D Compatibility (PKB) : 114.41 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.158

(partial model without unconserved sides chains): PDB file : Tito_5T5I.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5T5I-query.scw PDB file : Tito_Scwrl_5T5I.pdb: