Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------------------------------------MDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4Q6T Chain:A ((4-340))APFVLAYTDGQVEASYSNLQAFHRNLSAVGLGSTYGLTVTGKLRQDGMNETTQNIIRFAKSQSLPLYPTVSDYNEDIGAFDPAISHSILNDRALSAGTVKQLVKLAKEGGFAGINLD-FEKVEPRNRAAFCAFVKTLGNALHAS-----NKKLIISIPPKLSDTEPEYLQGYDYKALGAAVDYFQVMTYDQVGPGWSSGGFHNEAWPGPESGFDWQQALLSYAVSRVPASKVLAGLPTYGQDYSIGNRVHWSAYQEIIAEHRAAIHRDAASATPYATWGPVKSFVDGVEWTPERAQPVLWYDDAASIKTKTALVTRLGLGGTSVWAMGYENAGFWAALQSGLK


General information:
TITO was launched using:
RESULT:

Template: 4Q6T.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 229 8961 39.13 131.77
target 2D structure prediction score : 0.68
Monomeric hydrophicity matching model chain A : 0.50

3D Compatibility (PKB) : 39.13
2D Compatibility (Sec. Struct. Predict.) : 0.68
1D Compatibility (Hydrophobicity) : 0.50
QMean score : 0.570

(partial model without unconserved sides chains):
PDB file : Tito_4Q6T.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4Q6T-query.scw
PDB file : Tito_Scwrl_4Q6T.pdb: