Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKMKKYKIRKSGNSDVTTIPPEVKEFMGVQTGDAISYVFQSDGSVRMIKAQEEPDIDSLVDSIMNQYEDALKDLVDL 3ZVK Chain:F ((1-43)) ---MNKAKIFMNGQSQAVRLPKEF----RF-SVKEVSVIPL-GKGIVLQPLP--------------------------

General information: TITO was launched using: RESULT: Template: 3ZVK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 74 -10360 -140.00 -240.93 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain F : 0.64 3D Compatibility (PKB) : -140.00 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.586

(partial model without unconserved sides chains): PDB file : Tito_3ZVK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ZVK-query.scw PDB file : Tito_Scwrl_3ZVK.pdb: