Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)


Input alignment information:
Query sequenceMFKGVLFDLDGVITDTAEFHYRAWRKLGQEIGIT-IDHTFNEQLKGVSREDSLSLLLAYGGKEHSFSKEEFAELAKRKNDYYLEMIQTIEPKDVFPGVVPLLDSLKEEKIKIALASASKNGPFLLEKMGLTPYFDAIADPAEATNGKPAPDIFLLAAKAVGLKAEECIGIEDAQAGIQAILSSGAQPIGVGRAEDLGEEIPLVPDTTFLTIDYLKEKWHDHG
4C4S Chain:A ((1-216))MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDL---K--VSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVW----


General information:
TITO was launched using:
RESULT:

Template: 4C4S.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output 		Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1144 2406 2.10 11.35
target 2D structure prediction score : 0.67
Monomeric hydrophicity matching model chain A : 0.91

3D Compatibility (PKB) : 2.10
2D Compatibility (Sec. Struct. Predict.) : 0.67
1D Compatibility (Hydrophobicity) : 0.91
QMean score : 0.634

(partial model without unconserved sides chains):
PDB file : Tito_4C4S.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4C4S-query.scw
PDB file : Tito_Scwrl_4C4S.pdb: