Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY 3N84 Chain:A ((9-84)) WFFGKIPRAKAE-EMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVK-FNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3N84.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 273 -45383 -166.24 -597.14 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.79 3D Compatibility (PKB) : -166.24 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.716

(partial model without unconserved sides chains): PDB file : Tito_3N84.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3N84-query.scw PDB file : Tito_Scwrl_3N84.pdb: