Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY 1BMB Chain:A ((15-90)) WFFGKIPRAKAE-EMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVK-FNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 1BMB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 270 -41671 -154.34 -548.30 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.79 3D Compatibility (PKB) : -154.34 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.769

(partial model without unconserved sides chains): PDB file : Tito_1BMB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1BMB-query.scw PDB file : Tito_Scwrl_1BMB.pdb: