Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGMLSRLKAAQLVLTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQ------HLWFQSIFDMLEHF 1KA6 Chain:A ((6-87)) VYHGKISRETGEKLLLAT--GLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAF

General information: TITO was launched using: RESULT: Template: 1KA6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 251 -34183 -136.19 -449.77 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -136.19 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.515

(partial model without unconserved sides chains): PDB file : Tito_1KA6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1KA6-query.scw PDB file : Tito_Scwrl_1KA6.pdb: