Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence DPKNCKFNVLNGSGINVANGCCDVTKKQV----TVSPFTVSCTESCGLAIVS-GGDPTFSLQNAGRC 2MM0 Chain:A ((1-64)) ---NCVANILNINEAVIATGCVPAGGELRIFVGSSHSYLIKATSSCGLSLTNQVFINGESVQSGGRC

General information: TITO was launched using: RESULT: Template: 2MM0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 248 -5496 -22.16 -93.15 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -22.16 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.379

(partial model without unconserved sides chains): PDB file : Tito_2MM0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MM0-query.scw PDB file : Tito_Scwrl_2MM0.pdb: