Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQELLAQLQAGTAKFSDVLAYIEARYQHTPTAFQNGAQHNAATENQGSAKVFSFAKLQGLDQAQTLILFAEHYAS-VLAPPEGTDHQNIRQFMQNGWDGVKFEGQALTEK 3TFG Chain:B ((56-81)) -------------------------------------------------------SEVLGKPAEEWWIAFGEYWVTYTSEE------------------------------

General information: TITO was launched using: RESULT: Template: 3TFG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 19 -1033 -54.34 -41.30 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : -54.34 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.619

(partial model without unconserved sides chains): PDB file : Tito_3TFG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3TFG-query.scw PDB file : Tito_Scwrl_3TFG.pdb: