Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLRAISNSHGVLLPRSAIFMSVLFCLLIFQSLWNIAAAFCAHENQEKALHHFGHHAALNVYQTSSHTHVEHTETLDAAHKAPLNLQDHHDHLPTCFHVVMTEVAKQAQTPVLHVHELSQIYHWSNSYQSPHLSALKPPPVLTPL 2LTF Chain:A ((1-71)) ---------------------------------------------MKTFALQGDTLDAICVRYYGRT----EGVVETVLAANPGLAELGAVLPHGTAVELPDVQTAPVAETVNLWEVEHH------------------------

General information: TITO was launched using: RESULT: Template: 2LTF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 213 -26250 -123.24 -369.72 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -123.24 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.227

(partial model without unconserved sides chains): PDB file : Tito_2LTF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LTF-query.scw PDB file : Tito_Scwrl_2LTF.pdb: