Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------PEGTVALQARYPANNKKAG------------KVNAAANNGTAAGGNVNGTADFGKCKPTM-SFKTG-RPGR-KATEGTFLPDDELVAKG--------QQDALNPNIITNRICDQLTNVCSANAA-AKTQCAAAKAMVSSLGTKDSSTADAF-NKALGF-
3EC2 Chain:A ((1-180))AKRYWNANLDTYHPKNVSQNRALLTIRVFVHNFNPEEGKGLTFVGSPGVGKTHLAVATLKAIYEKKGIRGYFFDTKDLIFRLKHLMDEGKDTKFLKTVLNSPVLVLDDLGSERLSDWQRELISYIITYRYNNLKSTIITTNYSLQRSSVRISADLASRLGENVVSKIYE-MNELLVIK


General information:
TITO was launched using:
RESULT:

Template: 3EC2.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 428 29622 69.21 224.41
target 2D structure prediction score : 0.45
Monomeric hydrophicity matching model chain A : 0.63

3D Compatibility (PKB) : 69.21
2D Compatibility (Sec. Struct. Predict.) : 0.45
1D Compatibility (Hydrophobicity) : 0.63
QMean score : 0.237

(partial model without unconserved sides chains):
PDB file : Tito_3EC2.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3EC2-query.scw
PDB file : Tito_Scwrl_3EC2.pdb: