Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------PSDGPEAPEELCFTTIIRRRDGFKYAEKGPIGQKIAFLAGLNCTVQKGCKLA---CTPAHYGLKYKVSCRPA---------------------------------------------------------------------------------------------------------------------------- 5HON Chain:A ((1-206)) EEAKLTAHYSFDNNDLSDSTGNFGPGTITGNRIDNEGGTIAYAD-GKIG-KAAVLNG-----QSGIRLPDGLVSSNQYSVSLWVKPEQLTTHTTTFFGAKDPNHWISLVPQGWDGNTMLWSGSSPWYDGRTFWKIPTGQWTHLAFSVDNGAVKVYINGVEKFSGTNFPDVFTGANASFALGVNWWDPPFKGLIDELRIYEGALTPSQVTDLAQ

General information: TITO was launched using: RESULT: Template: 5HON.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 191 10079 52.77 162.56 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : 52.77 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.144

(partial model without unconserved sides chains): PDB file : Tito_5HON.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5HON-query.scw PDB file : Tito_Scwrl_5HON.pdb: