Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---GCQVELLNI-NQAVVGSGCVPFNYYANIYDSITRAGYTVEAN-INCGLKFQAGRRIPDG--YSLRRAGYC-
5MZ6 Chain:B ((118-191))LAADIEDDMLNLEDQDVVLSEDRPYGDVIDPAESEAEALAELGVEEWDSYPPIDPASRIGDDFNYVLRTEDFAE


General information:
TITO was launched using:
RESULT:

Template: 5MZ6.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 17 625 36.76 9.47
target 2D structure prediction score : 0.52
Monomeric hydrophicity matching model chain B : 0.74

3D Compatibility (PKB) : 36.76
2D Compatibility (Sec. Struct. Predict.) : 0.52
1D Compatibility (Hydrophobicity) : 0.74
QMean score : -0.130

(partial model without unconserved sides chains):
PDB file : Tito_5MZ6.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5MZ6-query.scw
PDB file : Tito_Scwrl_5MZ6.pdb: