Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFKTFLKDKEKIVNALQLPYSNAKLEATNNLIKLIKHNAFGFRNFENFKKERTKFVLSRSSLSSTHYS 4A94 Chain:C ((3-53)) -----VPDDRPCINPGRCPLVP---DATCTFVCKAADNDFGYECQHVWTFEGQRV---------GCYA

General information: TITO was launched using: RESULT: Template: 4A94.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 156 -9194 -58.93 -180.26 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain C : 0.65 3D Compatibility (PKB) : -58.93 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.154

(partial model without unconserved sides chains): PDB file : Tito_4A94.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4A94-query.scw PDB file : Tito_Scwrl_4A94.pdb: