Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MELAETSIVKKNHQIPCIINQKIAQKLI--EKTSMTDIDHQLSIST-STVIRKINNFHFEHDFSRLPEIMS 4KA4 Chain:E ((12-54)) ----------------QQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKS------------

General information: TITO was launched using: RESULT: Template: 4KA4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 104 2226 21.40 55.64 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain E : 0.62 3D Compatibility (PKB) : 21.40 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.703

(partial model without unconserved sides chains): PDB file : Tito_4KA4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4KA4-query.scw PDB file : Tito_Scwrl_4KA4.pdb: