Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------MLIVLISVIVAFLYHKITEYV------NNRKIDIVIFLSLLISHFIWNYYF----LPIEILIAISGANLLLSFLKKLQTK------------------------------------------------------------------------------------
5H35 Chain:C ((1-195))MYMILELLNIIGIIAFTISGSLKGTNKGLDIFGVVTLGVITSYAGGIIADILLGIYPPQILKELNYLLLSVGISIFVFYFYKWLQTNPIKMIIAISDAVGLSTFATLGASLAYSYGLNPISVGLIAAIVGTGGGVIRDVLVNEIPMVLTKEIYATAALLSGFIYYFTTPYLHHDSLFVAFLGSFLLRILSIKYNF


General information:
TITO was launched using:
RESULT:

Template: 5H35.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 177 -29313 -165.61 -418.76
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain C : 0.47

3D Compatibility (PKB) : -165.61
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.47
QMean score : 0.232

(partial model without unconserved sides chains):
PDB file : Tito_5H35.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5H35-query.scw
PDB file : Tito_Scwrl_5H35.pdb: