Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKCKKYEEFGLDSLLQETRGGRNHAYMTVEEEKAFLARHLKATEAGEFVTIDALFQAYKKKLGR-----SYTRDAFYQLLKRHGWRNIMPRPEHPKKADAQTIVASKNKISIQEDKKAL 1PDN Chain:C ((51-124)) SKILNRYQETGSIRP-GVIGGSKP-RIATPEIENRI-EEYKRS---SPGMFSWEIREKLI-REGVCDRSTAPSVSAISRLV---------------------------------------

General information: TITO was launched using: RESULT: Template: 1PDN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 110 -12214 -111.04 -177.01 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain C : 0.65 3D Compatibility (PKB) : -111.04 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.617

(partial model without unconserved sides chains): PDB file : Tito_1PDN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1PDN-query.scw PDB file : Tito_Scwrl_1PDN.pdb: