Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKMATDKNRIMISLDDKNLEKLENLVEDVRDRRGMRLTKSQVIELLLNTVDYFDDIMGAIYSKK 3V21 Chain:C ((45-87)) -----------------ENLDKLENYVKDVVKAKGLAIPTSGAFS---NTRGTWFEVMIAIQS--

General information: TITO was launched using: RESULT: Template: 3V21.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 56 -6472 -115.56 -150.50 target 2D structure prediction score : 0.91 Monomeric hydrophicity matching model chain C : 0.69 3D Compatibility (PKB) : -115.56 2D Compatibility (Sec. Struct. Predict.) : 0.91 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.698

(partial model without unconserved sides chains): PDB file : Tito_3V21.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3V21-query.scw PDB file : Tito_Scwrl_3V21.pdb: