Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMEFLLYTISKVKLLEDILMPQPIVPVEIPQSRPFDSKKRNDI-LLKIRIGKLEVSFFQSLNLEMVEQLLDKVLLYDNSSI
2N73 Chain:B ((1-80))GAMVEARSLAVAMGDTVVEPAPLKPTSEPTSGPPGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVKLLHGGVAV


General information:
TITO was launched using:
RESULT:

Template: 2N73.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 29 956 32.95 12.09
target 2D structure prediction score : 0.61
Monomeric hydrophicity matching model chain B : 0.61

3D Compatibility (PKB) : 32.95
2D Compatibility (Sec. Struct. Predict.) : 0.61
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.233

(partial model without unconserved sides chains):
PDB file : Tito_2N73.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2N73-query.scw
PDB file : Tito_Scwrl_2N73.pdb: