Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSQKLYNMKFAAVYLALIAKVERKGGKAESVHQVTSWLTGYEVSDVLACLDRD---VTYGDFFRQAPYYVPERIAITGKICGVRIEEIDDPLMQEIRRLDKLVDWLAKGKTSQQVLEKYEKHK 4NF1 Chain:D ((11-69)) -------------------------------------WKDLDLPRLQHLIQSSFRRTLIPHYFET---TPLLRAYVSENYRAAVI--LTKL--GNVPYLDKFA--------------------

General information: TITO was launched using: RESULT: Template: 4NF1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 155 -2415 -15.58 -43.12 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain D : 0.62 3D Compatibility (PKB) : -15.58 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.365

(partial model without unconserved sides chains): PDB file : Tito_4NF1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4NF1-query.scw PDB file : Tito_Scwrl_4NF1.pdb: