Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFVNRLMAILNPIMMGISSGLSVAIYWIGAYVINDAAPIARLPFFSDMIVFMSYAM 3QF4 Chain:B ((261-303)) -------GVLPPLMNMVNNLGFALISGFGGWLALKDI----IT-VGTIATFIGYS-

General information: TITO was launched using: RESULT: Template: 3QF4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 65 -18669 -287.22 -434.16 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain B : 0.65 3D Compatibility (PKB) : -287.22 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.058

(partial model without unconserved sides chains): PDB file : Tito_3QF4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3QF4-query.scw PDB file : Tito_Scwrl_3QF4.pdb: