Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLEIWKYRPFVSEFWNDFKNNHDKQFVDPISLYLTLKDDDDPRIEEESEALENMILQYLGEDDAS 1Q2Z Chain:A ((2-37)) -------------------------PVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDT----

General information: TITO was launched using: RESULT: Template: 1Q2Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 44 -1841 -41.83 -51.13 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -41.83 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.488

(partial model without unconserved sides chains): PDB file : Tito_1Q2Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Q2Z-query.scw PDB file : Tito_Scwrl_1Q2Z.pdb: