Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------------------------MRFEVLSTSLI---VTKIVFFVR------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3MGB Chain:B ((35-319))MNGIRWIASYPKAGNTWVRCMLAAYITGKAPQVWNDIDAESLTLEAMLRFGDLPPAEPMEPVLVKTHLKADVPVLGLYGEATAKVLYLVRNPRDMLLSSMRMASISRDDVEKSRDFARKFIANEGLGWNGVGLGSWPENVRSWTESSSDRFPNADVLTMRYEDLKGDPVARFSEIVEFLDLGGPVDIEDIRRAVAASTLERMRELEKRSEQQGGGSPIRPQFVGEGRYDQSLSFLGEDIESDYQELLHGDSGFALYAKQYGYAG


General information:
TITO was launched using:
RESULT:

Template: 3MGB.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 13 -2509 -192.96 -125.43
target 2D structure prediction score : 0.40
Monomeric hydrophicity matching model chain B : 0.54

3D Compatibility (PKB) : -192.96
2D Compatibility (Sec. Struct. Predict.) : 0.40
1D Compatibility (Hydrophobicity) : 0.54
QMean score : 0.159

(partial model without unconserved sides chains):
PDB file : Tito_3MGB.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3MGB-query.scw
PDB file : Tito_Scwrl_3MGB.pdb: