Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRQMMKMNKKSSYVVKRLLLVIIVLILGTLALGIGLMVGYGILGKGQDPWAILSPAKWQELIHKFTGN 4OGQ Chain:F ((6-27)) ---------------------LNAALLSFGLIFVGWALGALLL-------------------------

General information: TITO was launched using: RESULT: Template: 4OGQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 2 -790 -395.00 -35.91 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain F : 0.57 3D Compatibility (PKB) : -395.00 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.329

(partial model without unconserved sides chains): PDB file : Tito_4OGQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OGQ-query.scw PDB file : Tito_Scwrl_4OGQ.pdb: