Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MWIAISALNLAFAVMLGAFGAHGLKAHASPEQLAWWQTATDYFFYHALGLLALGILSKVLPHFPIKLSFLLIQIGILFFCGSLYIMALGLPRILGAITPIGGALMIAGWLILAWNAFKYAK 5ET1 Chain:C ((7-29)) -----------------RRRCQQPKMLSSPEDTMYYNQLN---------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5ET1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 11 -278 -25.27 -12.09 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain C : 0.36 3D Compatibility (PKB) : -25.27 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.36 QMean score : 0.523

(partial model without unconserved sides chains): PDB file : Tito_5ET1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5ET1-query.scw PDB file : Tito_Scwrl_5ET1.pdb: