Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPQVKLKEGEPVDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRKKAAAVKRYQKKLARESVRTTRLY 4G17 Chain:A ((236-274)) ------KRATPIEVLCENFP---EMATYLRYVRRLDFFEKPDYDYLRK-----------------------

General information: TITO was launched using: RESULT: Template: 4G17.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 52 -3577 -68.78 -91.71 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -68.78 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.705

(partial model without unconserved sides chains): PDB file : Tito_4G17.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4G17-query.scw PDB file : Tito_Scwrl_4G17.pdb: