Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIFTVSLHFARTVFNMRDIRCKRGCIMKKLFTILALCITVLTTSMASFADPPFDRGHGPKGPKGGPRGEWNDRGHKFDRDDNGDRVRDERRMREERGFERLKQHRWQPGYVMPQHYRGNGYKVDYKDNNLPKPDRNQQWYKINNDYILVDTDSNSIVSICGF 5AWW Chain:G ((1-75)) -----------------------MDLLYTLVILFYLGVAGLLVYLVLVQEPK----QGAGDLMGGSADLFSARG------VTGGLYRLTVILGVVFAALALVIGLWPR------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5AWW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 104 -10380 -99.80 -138.39 target 2D structure prediction score : 0.96 Monomeric hydrophicity matching model chain G : 0.57 3D Compatibility (PKB) : -99.80 2D Compatibility (Sec. Struct. Predict.) : 0.96 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.451

(partial model without unconserved sides chains): PDB file : Tito_5AWW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5AWW-query.scw PDB file : Tito_Scwrl_5AWW.pdb: