Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSKTLHSEKFA-INFFIVDQVPQFARRIMTQVPQIGSRCVFKEKRFDIVGVEWCLDEDATNYEYQARINIELKPV 4INO Chain:A ((296-309)) IALKAHPEAFKGVD-------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4INO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 7 -366 -52.29 -28.15 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : -52.29 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.892

(partial model without unconserved sides chains): PDB file : Tito_4INO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4INO-query.scw PDB file : Tito_Scwrl_4INO.pdb: