Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTKKNNAPELHKYRGLTSTEQMVIHQMLISYVREENCRFNIIMTGTAEPYNLVKLTSINFENEASAIWVHFETITGEQIALPIDFLSRIEFSGQQEI 2Q97 Chain:T ((55-73)) -------LDLRKYENLNTEQQKAYEQ-----------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2Q97.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 8 435 54.31 22.87 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain T : 0.55 3D Compatibility (PKB) : 54.31 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.440

(partial model without unconserved sides chains): PDB file : Tito_2Q97.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2Q97-query.scw PDB file : Tito_Scwrl_2Q97.pdb: