Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMFYLHSPFRLNITLRSKTMNAKFNPVTKLVEVQKGEPTTTTLQIALGLGLTHKSVIQLV---RTYLPDIQEFGRVRFE----------SCNSAFEMANSG---FDVRNSNQGRHTRYAILNEQ-QAYFLMTLMRNSPRVIDFKKALVKSFFEARVLLQTDYFALIQQREALNAKL--ECEKEIASSCGKGLATWK-KQRDCLTTAIANVDRQIQPCLFDGETI
1DKZ Chain:A ((1-215))-VLLLDVTPLSLGIETMG-----GVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVSIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQ--


General information:
TITO was launched using:
RESULT:

Template: 1DKZ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 785 12432 15.84 63.75
target 2D structure prediction score : 0.59
Monomeric hydrophicity matching model chain A : 0.65

3D Compatibility (PKB) : 15.84
2D Compatibility (Sec. Struct. Predict.) : 0.59
1D Compatibility (Hydrophobicity) : 0.65
QMean score : 0.364

(partial model without unconserved sides chains):
PDB file : Tito_1DKZ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1DKZ-query.scw
PDB file : Tito_Scwrl_1DKZ.pdb: