Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLRILKSILFEFEELMSQQSVEKKSVPWLLMGLGLLIPFLIIGILFLAAKSDAQNKKQYEQQRLEMEKRIAEKEAANSDKK 4J2L Chain:C ((1-25)) --------------MFVWTNVEPRSVA--VFPWHSLVPFLA----------------------------------------

General information: TITO was launched using: RESULT: Template: 4J2L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 2 -1249 -624.25 -49.94 target 2D structure prediction score : 0.08 Monomeric hydrophicity matching model chain C : 0.65 3D Compatibility (PKB) : -624.25 2D Compatibility (Sec. Struct. Predict.) : 0.08 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.418

(partial model without unconserved sides chains): PDB file : Tito_4J2L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4J2L-query.scw PDB file : Tito_Scwrl_4J2L.pdb: