Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MALSYGNKKWSLDEAEIPTYEDTWHLRVEVKEEAENIGGCTLFGKGFGNYDQDIKIKMFYS 4JHJ Chain:C ((2-20)) -------------------ATDSWAQAVDEQEAAAESI-----------------------

General information: TITO was launched using: RESULT: Template: 4JHJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 8 296 37.00 15.58 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain C : 0.54 3D Compatibility (PKB) : 37.00 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.647

(partial model without unconserved sides chains): PDB file : Tito_4JHJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4JHJ-query.scw PDB file : Tito_Scwrl_4JHJ.pdb: