Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------------------------------MGTYQRSKELKI-----VLFLSEFSNLLPKADETPLFLCYFIFSTTFFYQRKVDKTIVK--------------------------------------------------------------------------------------------------------------
4BB7 Chain:A ((16-251))HMDEVIVNNISYHVGDWALLRNQNDPQKPIVGQIFRLWKTPDGKQWLNACWYYRPEQTVHRVDRLFYKNEVMKTGQYRDHLVSNLVGKCYVIHFTRYQRGNPDMKEGPLFVCEFRYNES-------DKIFNKIRTWKACLPEEIRDLDEATIPVNGRKFFKYPSPIRHLLPANATPHDRVPEPTMGSPDAPPLVGAVYMRPKMQRDDLGEYATSDDCPRYIIRPNDSPEEGQVDIETGTITT


General information:
TITO was launched using:
RESULT:

Template: 4BB7.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 118 -5199 -44.06 -110.62
target 2D structure prediction score : 0.57
Monomeric hydrophicity matching model chain A : 0.57

3D Compatibility (PKB) : -44.06
2D Compatibility (Sec. Struct. Predict.) : 0.57
1D Compatibility (Hydrophobicity) : 0.57
QMean score : 0.482

(partial model without unconserved sides chains):
PDB file : Tito_4BB7.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4BB7-query.scw
PDB file : Tito_Scwrl_4BB7.pdb: