Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDKSEKLDHSL--LGKQRKTVETVFSSLEKLG-------CQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY 5G25 Chain:A ((10-91)) QTVVREMENFMERLRQDPQGIPALCNGALALGGKQGTCTAIPCNVAQDGGLACPTAGDVRAFQVVLRVEEKRLETVVYRPLE-

General information: TITO was launched using: RESULT: Template: 5G25.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 252 9205 36.53 126.09 target 2D structure prediction score : 0.23 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : 36.53 2D Compatibility (Sec. Struct. Predict.) : 0.23 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.286

(partial model without unconserved sides chains): PDB file : Tito_5G25.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5G25-query.scw PDB file : Tito_Scwrl_5G25.pdb: