Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKKQKQKLLNQFRPSLDGVRGQLFRSLEEESLRRYGLPLQVMLDPKNRQILTIGLAGKTNEDTRINVPIDDNFNTVLKRIRSGENGIFERFRDNLLIEIVSYWNDQRLKNDEPTAQAVATPVTEETVSVPEEKTEKPKADTTENTRSTDTNAALSFADFSKAVAEYPKFYTEQNEHEVVINEKNADEPRKLATISMTTENEFVIEKALERKYKVKLTLIPLIEQFAATAITDR 3L32 Chain:B ((98-129)) ----------------------------------------------------------------------DNVGVQIVRQMRSGE-RFLKIW-SQTVEEIVSYV----------------------------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3L32.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 37 -3775 -102.01 -117.95 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : -102.01 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.555

(partial model without unconserved sides chains): PDB file : Tito_3L32.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3L32-query.scw PDB file : Tito_Scwrl_3L32.pdb: