Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------------------------------------------------------------------------------------------------------------------------------------MVIGLFLGFKREFSKLIGFLVIALIAVGLVFNASGVKDVLLNLFNRIVGA------------------------- 3ENB Chain:A ((1771-1989)) LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA

General information: TITO was launched using: RESULT: Template: 3ENB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 112 -6451 -57.60 -129.02 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -57.60 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.265

(partial model without unconserved sides chains): PDB file : Tito_3ENB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ENB-query.scw PDB file : Tito_Scwrl_3ENB.pdb: