Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSKGQTLQDPFLNSLRKERIPVSIFLVNGIKLQGHIESFDQYVVLLKN-TVSQMVYKHAISTVVPARNPRPAGAQGAGFPAQGGSQGGFGGQGAGFGGAQGAGFGGQGGFGGQGGFGGQGGFGGQGGFGGQGGFGGQGGFGGHQGGFGGHQGGFDNDSKFEDGQDDENNR 5SZD Chain:L ((2-72)) SHMPYKLQESFLNTARKKRVKVSVYLVNGVRLQGRIRSFDLFTILLEDGKQQTLVYKHAITTIVPHERLEI---------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5SZD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 243 -37879 -155.88 -541.12 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain L : 0.69 3D Compatibility (PKB) : -155.88 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.439

(partial model without unconserved sides chains): PDB file : Tito_5SZD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5SZD-query.scw PDB file : Tito_Scwrl_5SZD.pdb: