Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHY 3N8M Chain:A ((8-83)) WFFGKIPRAK-----AEEMLSK-----QRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKV-LRDGAG--KYFLW-VVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3N8M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 268 -43809 -163.46 -576.43 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain A : 0.78 3D Compatibility (PKB) : -163.46 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.742

(partial model without unconserved sides chains): PDB file : Tito_3N8M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3N8M-query.scw PDB file : Tito_Scwrl_3N8M.pdb: