Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------MSMQQSYANILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVF--PSDNHEMVLVKNIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQIAEAVAEVTGARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFLSAVPESY
1FB1 Chain:A ((1-196))GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLN-DAIFDE-DHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS--


General information:
TITO was launched using:
RESULT:

Template: 1FB1.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 771 894 1.16 4.96
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain A : 0.87

3D Compatibility (PKB) : 1.16
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.87
QMean score : 0.498

(partial model without unconserved sides chains):
PDB file : Tito_1FB1.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1FB1-query.scw
PDB file : Tito_Scwrl_1FB1.pdb: