Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------WFHGMLSRLKAAQLVLTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRV--QHLWFQSIFDMLEHF--------------------- 1CSZ Chain:A ((1-112)) GSRRASVGSHEKMPWFHGKISREESEQIVLIGS-KTNGKFLIRARDN-NGSYALCLLHEGKVLHYRIDKDKTGKLSIPEG-KKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQ

General information: TITO was launched using: RESULT: Template: 1CSZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 234 8891 37.99 118.54 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : 37.99 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.550

(partial model without unconserved sides chains): PDB file : Tito_1CSZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1CSZ-query.scw PDB file : Tito_Scwrl_1CSZ.pdb: