Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence LFSSGTTIIRVQFVEITFYVDKDCRATKTDGQFLDGLYLQVGRKEEYKCYDQTVGPVPGRPGGVTPLLTTPAQENHRPAEQGLRLS 1Y0P Chain:A ((510-532)) -----------------VMIDTKAEVMNAKKQVIPGLYGA----------------------------------------------

General information: TITO was launched using: RESULT: Template: 1Y0P.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 48 -7959 -165.81 -346.04 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -165.81 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.667

(partial model without unconserved sides chains): PDB file : Tito_1Y0P.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Y0P-query.scw PDB file : Tito_Scwrl_1Y0P.pdb: