Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMSSKDSKCYTKLLTSYFKPRDSHKKGKSYKNSLSEEKEASTTGVNYYQLKTTVFTLN 1PSM Chain:A ((1-38)) ----------EAYKKAKQASQDAEQAAKDAENASKEAEEAAKEAVNLK----------

General information: TITO was launched using: RESULT: Template: 1PSM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 20 4258 212.90 112.05 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 212.90 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.502

(partial model without unconserved sides chains): PDB file : Tito_1PSM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1PSM-query.scw PDB file : Tito_Scwrl_1PSM.pdb: