Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSIHPDPQINRLNVLGEPLASCCFDPITGYFRNGFCHTAVTDLGQHTVCAQMTSEFLNFSQKVGNDLITPLPEAGFPGLQPGDFWCICVTRWVEAYQAGQAPPVKLHACHQAVLSYVPLDVLMEFAV 2NSU Chain:A ((433-485)) ----------------------------------------------------------FSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGY---------LSSLHLKAFTYINLD-------

General information: TITO was launched using: RESULT: Template: 2NSU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 78 -11841 -151.81 -223.42 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -151.81 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.253

(partial model without unconserved sides chains): PDB file : Tito_2NSU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2NSU-query.scw PDB file : Tito_Scwrl_2NSU.pdb: